PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM07G18780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 425aa    MW: 45092.3 Da    PI: 7.3239
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM07G18780.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.72.7e-54291571128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk++++
  OGLUM07G18780.1  29 LPPGFRFHPTDEELVVHYLKKKAASVPLPV-TIIAEVDLYKFDPWELPEKANFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPIMA 121
                      79****************************.89***************99999***************************************** PP

              NAM  95 k..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +  ++e+vg+kk Lvfy+g+ pkg+kt+W+mheyrl
  OGLUM07G18780.1 122 SgsTREKVGVKKALVFYRGKPPKGVKTNWIMHEYRL 157
                      9777788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-6425200IPR003441NAC domain
PROSITE profilePS5100561.65529200IPR003441NAC domain
PfamPF023657.9E-2830157IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MESPDSSSGS APPRVLRRQQ QQPGSAPELP PGFRFHPTDE ELVVHYLKKK AASVPLPVTI  60
IAEVDLYKFD PWELPEKANF GEQEWYFFSP RDRKYPNGAR PNRAATSGYW KATGTDKPIM  120
ASGSTREKVG VKKALVFYRG KPPKGVKTNW IMHEYRLTDT SSSAAAVATT RRPPPPITGG  180
SRGAVSLRLD DWVLCRIYKK TNKAGAGQRS MECEDSVEDA VAAYAPSSQQ HATAAAGMAG  240
SDGAGGVAAA HGGDYSSLLH HDSHEDTFLV NGLLTAEDAA GLSTGASSLS QLAAAARAAA  300
TPCDATKQLL APSPTPFNWF EAFLPRAKEF PGGLSRSSRD IGDMSLSSTV DRSLSEAGAV  360
AIDTGDAANG ANTMPAFINP LGVQGATYQQ HQAIMGASLP SESAAAAAAC NFQHPFQLSR  420
VNWDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-74182034171Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0634060.0AK063406.1 Oryza sativa Japonica Group cDNA clone:001-115-A08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645677.10.0PREDICTED: NAC transcription factor ONAC010
SwissprotA2YMR00.0NAC10_ORYSI; NAC transcription factor ONAC010
TrEMBLA0A0E0ALI90.0A0A0E0ALI9_9ORYZ; Uncharacterized protein
STRINGORGLA07G0243600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75723649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.19e-89NAC domain containing protein 25